3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11493
Human RPS6KB2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH06106 |
| Gene Id | 6199 |
| Gene Symbols | RPS6KB2 |
| Protein Name / Synonyms | KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, SRK, STK14B, p70(S6K)-beta, p70S6Kb |
| Clonality | Monoclonal |
| Immunogen Sequence | MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLE PVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGK VFQVRKVQGTNLGKIYAMKV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | Western Blot analysis of RPS6KB2 expression in transfected 293T cell line by RPS6KB2 monoclonal antibody . Lane 1: RPS6KB2 transfected lysate(53.4 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to RPS6KB2 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged RPS6KB2 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.