3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11499
Human RRM2B monoclonal antibody (50 ug)
| Size | 50 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_056528 |
| Gene Id | 50484 |
| Gene Symbols | RRM2B |
| Clonality | Monoclonal |
| Immunogen Sequence | DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRF VIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLK AD |
| Isotype | Kappa, IgG2b |
| Concentration (lot specific) | 0.39 mg/ml |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (34.76 KDa). |
![]() | Immunofluorescence of monoclonal antibody to RRM2B on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.