3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11528
Human SEMA7A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003603 |
| Gene Id | 8482 |
| Gene Symbols | SEMA7A |
| Protein Name / Synonyms | CD108, CDw108, H-SEMA-K1, H-Sema-L, JMH, MGC126692, MGC126696, SEMAK1, SEMAL |
| Clonality | Monoclonal |
| Immunogen Sequence | EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATY SWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEA QEGSYFREAQHWQLLPED |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Immunofluorescence of monoclonal antibody to SEMA7A on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SEMA7A is 1 ng/ml as a capture antibody. |
Your cart is empty.