3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11536
Human SET7 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_085151 |
| Gene Id | 80854 |
| Gene Symbols | SET7,SETD7 |
| Protein Name / Synonyms | FLJ21193, KIAA1717, KMT7, SET7, SET7/9, SET9 |
| Clonality | Monoclonal |
| Immunogen Sequence | SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKAN HSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYG YDHSPPGKSGPEAPEWYQVELKAFQATQQK |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | SET7 monoclonal antibody Western Blot analysis of SET7 expression in Jurkat . |
![]() | Immunoperoxidase of monoclonal antibody to SETD7 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.5 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to SET7 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SETD7 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.