3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11540
Human SFRS17A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005079 |
| Gene Id | 8227 |
| Gene Symbols | SFRS17A |
| Protein Name / Synonyms | 721P, CCDC133, CXYorf3, DXYS155E, MGC125365, MGC125366, MGC39904, XE7, XE7Y |
| Clonality | Monoclonal |
| Immunogen Sequence | ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSF LACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFR DAKDMNETLPGERPDTIHLEGLPC |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, IHC, ELISA, Immunofluorescence, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.18 KDa). |
![]() | SFRS17A monoclonal antibody Western Blot analysis of SFRS17A expression in Hela NE . |
![]() | Western Blot analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody. Lane 1: SFRS17A transfected lysate(51.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to SFRS17A on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.