3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11543
Human SFXN3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH00124.2 |
| Gene Id | 81855 |
| Gene Symbols | SFXN3 |
| Protein Name / Synonyms | BA108L7.2, SFX3 |
| Clonality | Monoclonal |
| Immunogen Sequence | MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNL LLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDS AFHPDTGEKVVLIGRMSAQV |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | SFXN3 monoclonal antibody Western Blot analysis of SFXN3 expression in Hela NE . |
![]() | Western Blot analysis of SFXN3 expression in transfected 293T cell line by SFXN3 monoclonal antibody. Lane 1: SFXN3 transfected lysate (Predicted MW: 35.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged SFXN3 is 1 ng/ml as a capture antibody. |
Your cart is empty.