3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11586
Human SLK monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_055535 |
| Gene Id | 9748 |
| Gene Symbols | SLK |
| Protein Name / Synonyms | KIAA0204, LOSK, MGC133067, STK2, bA16H23.1, se20-9 |
| Clonality | Monoclonal |
| Immunogen Sequence | KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLK ELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFK MTGESECLNPSTQSRISKFYPIPSLHSTGS |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | SLK monoclonal antibody Western Blot analysis of SLK expression in Hela NE . |
![]() | Immunoperoxidase of monoclonal antibody to SLK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Your cart is empty.