3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11587
Human SLMAP monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_009090 |
| Gene Id | 7871 |
| Gene Symbols | SLMAP |
| Protein Name / Synonyms | FLJ42206, KIAA1601, MGC138760, MGC138761, SLAP |
| Clonality | Monoclonal |
| Immunogen Sequence | LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDS ADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ EKQSITDELKQCKNNLKLLREKGNNKPW |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.62 KDa). |
![]() | SLMAP monoclonal antibody Western Blot analysis of SLMAP expression in A-431 . |
![]() | Immunoperoxidase of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged SLMAP is 0.3 ng/ml as a capture antibody. |
Your cart is empty.