3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11614
Human SNAI2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003059 |
| Gene Id | 6591 |
| Gene Symbols | SNAI2 |
| Clonality | Monoclonal |
| Immunogen Sequence | KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKT YSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.5 mg/ml |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (33.77 KDa). |
![]() | SNAI2 monoclonal antibody Western Blot analysis of SNAI2 expression in Hela NE . |
![]() | Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.