3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11649
Human SPG3A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | NP_056999 |
| Gene Id | 51062 |
| Gene Symbols | SPG3A,ATL1 |
| Protein Name / Synonyms | AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIV KDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGK SFLMDFMLRYMYNQESVDWV |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in PC-12 . |
![]() | SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in IMR-32 . |
![]() | Detection limit for recombinant GST tagged SPG3A is approximately 1ng/ml as a capture antibody. |
Your cart is empty.