3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11666
Human SSH3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_060327 |
| Gene Id | 54961 |
| Gene Symbols | SSH3 |
| Protein Name / Synonyms | FLJ10928, FLJ20515, SSH-3 |
| Clonality | Monoclonal |
| Immunogen Sequence | SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRI FPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPER FTYHNVRLWDEESAQLLPH |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunoprecipitation, Western Blotting, ELISA, IHC, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | SSH3 monoclonal antibody Western Blot analysis of SSH3 expression in A-431 . |
![]() | Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate(73 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ~ 10 ug/ml] |
![]() | Immunoprecipitation of SSH3 transfected lysate using anti-SSH3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SSH3 monoclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SSH3 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.