3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11671
Human STAU2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_055208 |
| Gene Id | 27067 |
| Gene Symbols | STAU2 |
| Protein Name / Synonyms | 39K2, 39K3, DKFZp781K0371, MGC119606 |
| Clonality | Monoclonal |
| Immunogen Sequence | LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTES TLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIY RPLDPKPFP |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.53 KDa). |
![]() | STAU2 monoclonal antibody Western Blot analysis of STAU2 expression in SW-13 . |
![]() | STAU2 monoclonal antibody Western Blot analysis of STAU2 expression in IMR-32 . |
![]() | Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.