3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11678
Human STK25 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH07852 |
| Gene Id | 10494 |
| Gene Symbols | STK25 |
| Protein Name / Synonyms | DKFZp686J1430, SOK1, YSK1 |
| Clonality | Monoclonal |
| Immunogen Sequence | FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLST LVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGI SDKLMVHLVERVQRFSHNRNHLTSTR |
| Isotype | Kappa, IgG3 |
| Recommended Applications | Western Blotting, Immunoprecipitation, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | STK25 monoclonal antibody Western Blot analysis of STK25 expression in K-562 . |
![]() | Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody . Lane 1: STK25 transfected lysate (Predicted MW: 48.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of STK25 transfected lysate using anti-STK25 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK25 monoclonal antibody. |
Your cart is empty.