3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11683
Human STK40 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_114406 |
| Gene Id | 83931 |
| Gene Symbols | STK40 |
| Protein Name / Synonyms | MGC4796, RP11-268J15.4, SHIK, SgK495 |
| Clonality | Monoclonal |
| Immunogen Sequence | PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEE KSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAIL AQRYLR |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.2 KDa). |
![]() | STK40 monoclonal antibody Western Blot analysis of STK40 expression in HepG2 . |
![]() | Immunoperoxidase of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
Your cart is empty.