3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11697
Human SUMO1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_001005781.1 |
| Gene Id | 7341 |
| Gene Symbols | SUMO1 |
| Protein Name / Synonyms | DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1 |
| Clonality | Monoclonal |
| Immunogen Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKM TTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGGHSTV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (38 KDa). |
![]() | Western Blot analysis of SUMO1 expression in transfected 293T cell line by SUMO1 monoclonal antibody. Lane 1: SUMO1 transfected lysate (Predicted MW: 11.6 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to SUMO1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SUMO1 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.