Human SWAP70 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_055870 |
| Gene Id | 23075 |
| Gene Symbols | SWAP70 |
| Protein Name / Synonyms | FLJ39540, HSPC321, KIAA0640, SWAP-70 |
| Clonality | Monoclonal |
| Immunogen Sequence | QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQ RVRELEDMYLKLQEALEDERQARQDEETVRKLQA |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (33.88 KDa). |
![]() | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in human spleen. |
![]() | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in Raw 264.7. |
![]() | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in PC-12. |
![]() | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in NIH/3T3. |
![]() | Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody. Lane 1: SWAP70 transfected lysate(69 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged SWAP70 is approximately 0.1ng/ml as a capture antibody. |
Anti-SWAP70 Antibody
Anti-SWAP70 Antibody
Your cart is empty.