3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 144-62448
Tafazzin / TAZ pAb
| Size | 20 µL, 100 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Rabbit |
| Accession Number | Q16635 |
| Gene Id | 6901 |
| Gene Symbols | TAZ |
| Protein Name / Synonyms | TAZ, BTHS, CMD3A, EFE, EFE2, G4.5, LVNCX, Taz1, tafazzin, |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1). |
| Immunogen Sequence | NDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
| Isotype | IgG |
| Purity | Affinity purification |
| Buffers | PBS with 0.01% thimerosal, 50% glycerol, pH7.3 |
| Recommended Applications | Western Blotting, 1:1000 - 1:5000 |
| Research Area | Cardiovascular Disease, Hippo Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |

Your cart is empty.