3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11730
Human TAPBPL monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_060479 |
| Gene Id | 55080 |
| Gene Symbols | TAPBPL |
| Protein Name / Synonyms | FLJ10143, TAPBP-R, TAPBPR |
| Clonality | Monoclonal |
| Immunogen Sequence | PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASL VLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLV QIPQAEALLHADCSGKEVT |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | TAPBPL monoclonal antibody Western Blot analysis of TAPBPL expression in A-431 . |
![]() | Western Blot analysis of TAPBPL expression in transfected 293T cell line by TAPBPL monoclonal antibody. Lane 1: TAPBPL transfected lysate(50.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged TAPBPL is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.