Human TCF12 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_996919 |
| Gene Id | 6938 |
| Gene Symbols | TCF12 |
| Protein Name / Synonyms | HEB, HTF4, HsT17266, bHLHb20 |
| Clonality | Monoclonal |
| Immunogen Sequence | VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQ LHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAV GPSTSLPAGH |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.64 KDa). |
![]() | Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | TCF12 monoclonal antibody Western Blot analysis of TCF12 expression in Jurkat . |
![]() | Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody. Lane 1: TCF12 transfected lysate(75.8 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to TCF12 on HeLa cell. [antibody concentration 10 ug/ml] |
Anti-TCF12 Antibody
Anti-TCF12 Antibody
Sign up to get promotions on your favorite research tools and research updates.