3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11764
Human TEKT2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_055281 |
| Gene Id | 27285 |
| Gene Symbols | TEKT2 |
| Protein Name / Synonyms | TEKTB1, TEKTIN-T, h-tektin-t |
| Clonality | Monoclonal |
| Immunogen Sequence | MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQ EARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDK CLTDLDAEIDALTQMKESA |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | TEKT2 monoclonal antibody Western Blot analysis of TEKT2 expression in human colon. |
![]() | TEKT2 monoclonal antibody Western Blot analysis of TEKT2 expression in HeLa. |
Your cart is empty.