3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11766
Human TESK2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH33085 |
| Gene Id | 10420 |
| Gene Symbols | TESK2 |
| Protein Name / Synonyms | None |
| Clonality | Monoclonal |
| Immunogen Sequence | GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVG REESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAM DCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTP ATFSTSGIGLQTQGKQDG |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (40.81 KDa). |
![]() | Western Blot analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody. Lane 1: TESK2 transfected lysate(60.3 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.5 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged TESK2 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.