3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11801
Human TLX3 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_066305 |
| Gene Id | 30012 |
| Gene Symbols | TLX3 |
| Protein Name / Synonyms | HOX11L2, MGC29804, RNX |
| Clonality | Monoclonal |
| Immunogen Sequence | ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREA ERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFAL QNLQPWEEDSSKVPAVTSLV |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Western blot analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | TLX3 monoclonal antibody Western Blot analysis of TLX3 expression in MCF-7 . |
![]() | Western Blot analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody. Lane 1: TLX3 transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.