3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11842
Human TRIM25 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005073 |
| Gene Id | 7706 |
| Gene Symbols | TRIM25 |
| Protein Name / Synonyms | EFP, RNF147, Z147, ZNF147 |
| Clonality | Monoclonal |
| Immunogen Sequence | SQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKA LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQT LKEEIEQSLTKRDEFEFLEK |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, IHC, Immunofluorescence, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | TRIM25 monoclonal antibody Western Blot analysis of TRIM25 expression in Hela NE . |
![]() | Immunoperoxidase of monoclonal antibody to TRIM25 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to TRIM25 on HeLa cell. [antibody concentration 20 ug/ml] |
Your cart is empty.