3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11847
Human TRIP6 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003293 |
| Gene Id | 7205 |
| Gene Symbols | TRIP6 |
| Protein Name / Synonyms | MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP1, ZRP-1 |
| Clonality | Monoclonal |
| Immunogen Sequence | SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRP GSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPA YRTGSLKPNPASPLPASP |
| Isotype | Kappa, IgG3 |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | TRIP6 monoclonal antibody Western Blot analysis of TRIP6 expression in Hela NE . |
![]() | Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 monoclonal antibody. Lane 1: TRIP6 transfected lysate(50.3 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to TRIP6 on HeLa cell. [antibody concentration 35 ug/ml] |
![]() | Detection limit for recombinant GST tagged TRIP6 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.