3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11870
Human TWIST1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_000465.1 |
| Gene Id | 7291 |
| Gene Symbols | TWIST1 |
| Clonality | Monoclonal |
| Immunogen Sequence | LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSK IQTLKLAARYIDFLYQVLQSDELDSKMAS |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 1mg/ml |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (33.22 KDa). |
![]() | Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged TWIST1 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.