3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11871
Human TWIST2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH33168 |
| Gene Id | 117581 |
| Gene Symbols | TWIST2 |
| Protein Name / Synonyms | DERMO1, MGC117334, bHLHa39 |
| Clonality | Monoclonal |
| Immunogen Sequence | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSS EDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQ SLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV LQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, Immunoprecipitation, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (43.34 KDa). |
![]() | Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of TWIST2 transfected lysate using anti-TWIST2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST2 MaxPab rabbit polyclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.