3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11875
Human TYMS monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH13919 |
| Gene Id | 7298 |
| Gene Symbols | TYMS |
| Protein Name / Synonyms | HsT422, MGC88736, TMS, TS, TSase |
| Clonality | Monoclonal |
| Immunogen Sequence | ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDME SDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLM ALPPCHALCQFYVVNSELSC |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, Western Blotting, IHC, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody. Lane 1: TYMS transfected lysate(35.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 1.5 ug/ml] |
![]() | Immunoprecipitation of TYMS transfected lysate using anti-TYMS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TYMS MaxPab rabbit polyclonal antibody. |
Your cart is empty.