3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11889
Human UCKL1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse |
| Host Species | Mouse |
| Accession Number | NP_060329 |
| Gene Id | 54963 |
| Gene Symbols | UCKL1 |
| Protein Name / Synonyms | UCK1-LIKE, UCK1L, URKL1 |
| Clonality | Monoclonal |
| Immunogen Sequence | EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTII RDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCVVQTPQ GQDYAGKCYAGKQITGVSIL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | UCKL1 monoclonal antibody Western Blot analysis of UCKL1 expression in NIH/3T3 . |
![]() | Immunofluorescence of monoclonal antibody to UCKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged UCKL1 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.