3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11903
Human UPB1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_057411.1 |
| Gene Id | 51733 |
| Gene Symbols | UPB1 |
| Protein Name / Synonyms | BUP1 |
| Clonality | Monoclonal |
| Immunogen Sequence | AINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDS SRTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEM YARELAEAVKSNYSPTIVKE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | UPB1 monoclonal antibody. Western Blot analysis of UPB1 expression in human liver. |
![]() | UPB1 monoclonal antibody. Western Blot analysis of UPB1 expression in Jurkat . |
![]() | Western Blot analysis of UPB1 expression in transfected 293T cell line by UPB1 monoclonal antibody . Lane 1: UPB1 transfected lysate (Predicted MW: 43.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to UPB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged UPB1 is 1 ng/ml as a capture antibody. |
Your cart is empty.