3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11906
Human USF2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | NP_003358 |
| Gene Id | 7392 |
| Gene Symbols | USF2 |
| Protein Name / Synonyms | FIP, bHLHb12 |
| Clonality | Monoclonal |
| Immunogen Sequence | MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDG PGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYR VVQVTDGQLDGQGDTAGAVS |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | USF2 monoclonal antibody Western Blot analysis of USF2 expression in PC-12 . |
![]() | USF2 monoclonal antibody Western Blot analysis of USF2 expression in different cell lines. |
![]() | USF2 monoclonal antibody Western Blot analysis of USF2 expression in Hela NE . |
![]() | Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged USF2 is approximately 10ng/ml as a capture antibody. |
Your cart is empty.