3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11936
Human VRK1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003375 |
| Gene Id | 7443 |
| Gene Symbols | VRK1 |
| Protein Name / Synonyms | MGC117401, MGC138280, MGC142070 |
| Clonality | Monoclonal |
| Immunogen Sequence | DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQ GLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESK EPGVEDTEWSNTQTEEAIQTRSRTRKRVQK |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunoprecipitation, Immunofluorescence, Western Blotting, ELISA, |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate(45.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of VRK1 transfected lysate using anti-VRK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with VRK1 monoclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged VRK1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.