3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11940
Human WNT5A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH64694 |
| Gene Id | 7474 |
| Gene Symbols | WNT5A |
| Protein Name / Synonyms | hWNT5A |
| Clonality | Monoclonal |
| Immunogen Sequence | ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNS RGKLVQVNSRFNSPTTQDLV |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, IHC |
| Research Area | Wnt-beta-Catenin Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged WNT5A is 3 ng/ml as a capture antibody. |
Your cart is empty.