3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11947
Human YES1 monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH48960 |
| Gene Id | 7525 |
| Gene Symbols | YES1 |
| Protein Name / Synonyms | HsT441, P61-YES, Yes, c-yes |
| Clonality | Monoclonal |
| Immunogen Sequence | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVS PCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (34.54 KDa). |
![]() | YES1 monoclonal antibody Western Blot analysis of YES1 expression in Jurkat . |
![]() | YES1 monoclonal antibody Western Blot analysis of YES1 expression in Hela NE . |
Your cart is empty.