3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11954
Human ZBTB16 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH29812 |
| Gene Id | 7704 |
| Gene Symbols | ZBTB16 |
| Protein Name / Synonyms | PLZF, ZNF145 |
| Clonality | Monoclonal |
| Immunogen Sequence | QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKA FVCDQCGAQFSKEDALETHR |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, Proximity Ligation Analysis, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody. Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between TRAF2 and ZBTB16 HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-ZBTB16 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody. |
Your cart is empty.