3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11956
Human ZEB1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_110378 |
| Gene Id | 6935 |
| Gene Symbols | ZEB1 |
| Protein Name / Synonyms | AREB6, BZP, DELTA-EF1, MGC133261, NIL-2-A, NIL-2A, NIL2A, TCF8, ZEB, ZFHEP, ZFHX1A |
| Clonality | Monoclonal |
| Immunogen Sequence | NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSN VEDQNDSDSTPPKKKMRKTE |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Immunofluorescence, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Immunofluorescence of monoclonal antibody to ZEB1 on U-2 OS cell. [antibody concentration 10 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue). |
![]() | Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody. |
Your cart is empty.