3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11985
Human ZNF313 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH13695 |
| Gene Id | 55905 |
| Gene Symbols | ZNF313,RNF114 |
| Protein Name / Synonyms | ZNF313 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPV QVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAVEL ERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEG VKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEHC KLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHR FSYDTFVDYDVDEEDMMNQVLQRSIIDQ |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (50.82 KDa). |
![]() | ZNF313 monoclonal antibody 1A10 Western Blot analysis of ZNF313 expression in HepG2 . |
![]() | Western Blot analysis of ZNF313 expression in transfected 293T cell line by ZNF313 monoclonal antibody 1A10. Lane 1: ZNF313 transfected lysate(25.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to ZNF313 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged ZNF313 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.