3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 228-11568
| Size | 50 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | P19429 |
| Gene Id | 7137 |
| Protein Name / Synonyms | Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817. |
| Expressed Region | MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ
IAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEE
RYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKE
SLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES |
| Expression System | E. coli |
| Purity | > 95.0% |
| Purity Determined By | SDS-PAGE |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder |
| Formulation | Human TNNI3 was lyophilized in 0.01M HCl |
| Reconstitution | It is recommended to reconstitute the lyophilized TNNI3 with urea /Tris buffer (20mM Tris, pH 7.5, 5 mM EDTA, 7 M urea and 15 mM 2-mercaptoethanol) not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Research Area | Cardiovascular Disease |
| Shipping Type | Blue ice |
| Storage | -20°C |
Your cart is empty.