3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 228-10558
| Size | 10 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | P60983 |
| Gene Id | 2764 |
| Protein Name / Synonyms | Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF. |
| Expressed Region | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH. |
| Expression System | E. coli |
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
| Research Area | Neuroscience |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.