3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Helicobacter Pylori Outer Membrane Protein Recombinant
Catalog #: 228-11712
Product Description
Specifications
| Size | 500 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Bacteria |
| Expressed Region | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL. |
| Expression System | E. coli |
| Purity | Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
| Purity Determined By | Purified by proprietary chromatographic technique. |
| Format | Sterile filtered liquid formulation. |
| Formulation | The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
| Shipping Type | Blue ice |
| Storage | -20°C |
Description
Description
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Stability & Storage
Storage/Stability
Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.