3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Heregulin-B2, Human Recombinant
Catalog #: 228-11163
Product Description
Specifications
| Size | 50 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | Q02297 |
| Gene Id | 3084 |
| Protein Name / Synonyms | Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1. |
| Expressed Region | shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvmasfykaeelyq. |
| Expression System | E. coli |
| Purity | Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2 um filtered solution in 20mM PB, pH 7.4, containing 150mM NaCl. |
| Activity | The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2×104 Units/mg. |
| Research Area | Cancer |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Introduction
Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that neuregulin recombinant could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that neuregulin (NRG1) recombinant can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.
Description
Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques.
Stability & Storage
Storage/Stability
Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.