Loading...
Loading...
Loading...
Loading...
HIV-1 Integrase Recombinant
| Size | 500 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Expressed Region | mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh. |
| Expression System | E. coli |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Format | Sterile filtered colorless clear solution. |
| Formulation | 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. |
| Recommended Applications | HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems. |
| Research Area | Infectious Disease, HIV |
| Shipping Type | Blue ice |
| Storage | -20°C |
Your cart is empty.
HIV-1 Integrase Recombinant