Mouse Anti-Human ABCA10

Human ABCA10 monoclonal antibody (100 ug)

$412.00  
101-10002
+

Antigen Information

Accession Number:
  • NP_525021
Gene ID:
  • 10349
Gene Symbols:
  • ABCA10
Protein Name & Synonyms:
ABCA10
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIF SDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

EST698739

Description

Mouse monoclonal antibody raised against a partial recombinant ABCA10.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_080282

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (34.54 KDa).
Detection limit for recombinant GST tagged ABCA10 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.