Mouse Anti-Human ABTB1

Human ABTB1 monoclonal antibody (100 ug)

$412.00
101-10012
+

Antigen Information

Accession Number:
  • NP_742024
Gene ID:
  • 80325
Gene Symbols:
  • ABTB1
Protein Name & Synonyms:
ABTB1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEE PATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAY DVLSVADMYLLPGLKRLCGR
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

BPOZ, Btb3, EF1ABP, MGC20585, PP2259

Description

Mouse monoclonal antibody raised against a partial recombinant ABTB1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_172027

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged ABTB1 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.