Mouse Anti-Human ATRX

Human ATRX monoclonal antibody (100 ug)

$412.00  
101-10135
+

Antigen Information

Accession Number:
  • NP_000480
Gene ID:
  • 546
Gene Symbols:
  • ATRX
Protein Name & Synonyms:
ATRX
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPL EDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAI YNDVLTKQQMLISCVQRILM
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

ATR2, MGC2094, MRXHF1, RAD54, RAD54L, SFM1, SHS, XH2, XNP, ZNF-HX

Description

Mouse monoclonal antibody raised against a partial recombinant ATRX.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_000489

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Detection limit for recombinant GST tagged ATRX is approximately 0.1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.