Mouse Anti-Human FBXO7

Human FBXO7 monoclonal antibody (100 ug)

$412.00  
101-10517
+

Antigen Information

Accession Number:
  • NP_036311
Gene ID:
  • 25793
Gene Symbols:
  • FBXO7
Protein Name & Synonyms:
FBXO7
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELY RKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPS SRLPPGIIGGEYDQRPTLP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

DKFZp686B08113, FBX, FBX07, FBX7, PARK15, PKPS

Description

Mouse monoclonal antibody raised against a partial recombinant FBXO7.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_012179

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
Immunofluorescence of monoclonal antibody to FBXO7 on HeLa cell. [antibody concentration 10 ug/ml]

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.