Mouse Anti-Human PRKACA

Human PRKACA monoclonal antibody (100 ug)

$412.00
101-11322
+

Antigen Information

Accession Number:
  • AAH39846
Gene ID:
  • 5566
Gene Symbols:
  • PRKACA
Protein Name & Synonyms:
PRKACA
Target Species:
  • Human

Antibody Specifications

Applications:
Proximity Ligation Analysis, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAH LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

MGC102831, MGC48865, PKACA

Description

Mouse monoclonal antibody raised against a partial recombinant PRKACA.

Source

Specificity
Human

Gene Information

Gene Accession #
BC039846

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (38.94 KDa).
Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and PRKACA HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-PRKACA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged PRKACA is approximately 0.1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.