3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Human pro-BNP (1-108) Recombinant
Catalog #: 227-10136
pro-Brain Natriuretic Peptide (proBNP) (a.a. 1-108) Recombinant
Product Description
Specifications
| Size | 10 µg |
| Estimated Lead Time | 3-4 weeks |
| Species | Human |
| Expression System | E. coli |
| Purity Determined By | > 95% pure (SDS-PAGE). |
| Molecular Weight (kDa) | 12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence). |
| Format | Purified, Lyophilized |
| Formulation | Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer. |
| Concentration (lot specific) | 10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization). |
| Preservative | None |
| Recommended Applications | Specific methodologies have not been tested using this product. |
| Research Area | Neuroscience, Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Specifications
Size
10 ug
Stability & Storage
Storage/Stability
Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.