Mouse Anti-Human TTYH1

Human TTYH1 monoclonal antibody (100 ug)

$412.00
101-11863
+

Antigen Information

Accession Number:
  • NP_065710
Gene ID:
  • 57348
Gene Symbols:
  • TTYH1
Protein Name & Synonyms:
TTYH1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYY LLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQF PSAQKPLLSLEETLNVTEGN
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

None

Description

Mouse monoclonal antibody raised against a partial recombinant TTYH1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_020659

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.