3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 228-10819
| Size | 100 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | Q86UP4 |
| Protein Name / Synonyms | Interferon alpha 2b, IFNA, INFA2, MGC125764, MGC125765. |
| Expressed Region | MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE. |
| Expression System | E. coli |
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a (1 mg/ml) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer. |
| Activity | The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 260,000,000 IU/ mg. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.