3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
IP-10, Human Recombinant (CXCL10)
Catalog #: 228-10970
Product Description
Specifications
| Size | 25 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | P02778 |
| Gene Id | 3627 |
| Protein Name / Synonyms | Small inducible cytokine B10, CXCL10, 10 kDa interferon-gamma-induced protein, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10. |
| Expressed Region | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP. |
| Expression System | E. coli |
| Purity | Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Molecular Weight (kDa) | 8.6 kDa |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2 um filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4 and 150mM NaCl. |
| Activity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg. |
| Research Area | Angiogenesis, Inflammation, Chemokine Biology |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Stability & Storage
Storage/Stability
Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.